PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010921105.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 389aa    MW: 42133.7 Da    PI: 9.8106
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010921105.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.11.8e-53161431128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeelvv+yLkkk+++ +l++ ++i+evd+yk++Pw+Lp k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk++l++
  XP_010921105.1  16 LPPGFRFHPTDEELVVHYLKKKAASVPLPV-TIIAEVDLYKFDPWELPGKANFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPILTS 109
                     79****************************.89***************999999***************************************99 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++++vg+kk Lvfy g+ pkg kt+W+mheyrl
  XP_010921105.1 110 gGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRL 143
                     77788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-6410179IPR003441NAC domain
PROSITE profilePS5100562.08716179IPR003441NAC domain
PfamPF023657.1E-2817143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MESTDSSGSQ QQQPQLPPGF RFHPTDEELV VHYLKKKAAS VPLPVTIIAE VDLYKFDPWE  60
LPGKANFGEQ EWYFFSPRDR KYPNGARPNR AATSGYWKAT GTDKPILTSG GTQKVGVKKA  120
LVFYGGKPPK GIKTNWIMHE YRLADSSPSS SARPPGGDVG SKKGSLRLDD WVLCRIYKKN  180
SSSNNNGRLT DRDKEDSMDG MLAPPALTPH RAIGTQTNPR PQPQRAPNNY TALLGNDETF  240
FEGLLTTEDG LAANPMTQFA GAPRAKLDLS TVQTNSGTLA PKRPLTSPYW SDGGMGTPPP  300
TKRFQGCNHG SSGNSTTTNN NTSSGSNSSA TTNNNNNSNN NHGGHTITAL LNQIPQGTAY  360
QPQTILSSLG DGSAIFRQPY QLSGMNWSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-771318514171NO APICAL MERISTEM PROTEIN
1ut4_B7e-771318514171NO APICAL MERISTEM PROTEIN
1ut7_A7e-771318514171NO APICAL MERISTEM PROTEIN
1ut7_B7e-771318514171NO APICAL MERISTEM PROTEIN
3swm_A9e-771318517174NAC domain-containing protein 19
3swm_B9e-771318517174NAC domain-containing protein 19
3swm_C9e-771318517174NAC domain-containing protein 19
3swm_D9e-771318517174NAC domain-containing protein 19
3swp_A9e-771318517174NAC domain-containing protein 19
3swp_B9e-771318517174NAC domain-containing protein 19
3swp_C9e-771318517174NAC domain-containing protein 19
3swp_D9e-771318517174NAC domain-containing protein 19
4dul_A7e-771318514171NAC domain-containing protein 19
4dul_B7e-771318514171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010921105.10.0PREDICTED: NAC transcription factor NAM-B2-like
SwissprotA0SPJ91e-116NAM2_HORVD; NAC transcription factor NAM-2
TrEMBLM0RY951e-148M0RY95_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr1P08860_0011e-147(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP75723649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.12e-96NAC domain containing protein 2